Round Shape Amethyst Cluster Flower Ring for Women

Sale price $1,576.00 Regular price $1,771.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Amethyst Cluster Flower Ring

This ring features a cluster arrangement of round amethyst gemstones designed to resemble a delicate flower. The vibrant purple tones of the stones create a striking centerpiece, while the clustered layout enhances the ring’s visual depth and dimension.

The floral inspiration gives the ring a decorative and expressive style, making it a distinctive choice for those who appreciate gemstone jewelry with artistic detailing.

Cluster Flower Design

Cluster rings use multiple smaller gemstones arranged closely together to create the appearance of a larger design motif. In this ring, the gemstones are positioned in a floral pattern that resembles the petals of a flower.

This layout provides an intricate visual structure while allowing each gemstone to contribute to the overall brilliance of the piece.

Round Cut Amethyst Stones

Amethyst is recognized for its rich purple color and long-standing presence in fine jewelry traditions. The round cut gemstones used in the design emphasize balanced symmetry and light reflection.

The purple hue of amethyst creates a vibrant focal point, offering a distinctive alternative to colorless gemstones.

Decorative Statement Style

Flower-inspired cluster rings are often chosen for their decorative character and unique visual appeal. The combination of multiple gemstones and a floral arrangement creates a ring that stands out while maintaining an elegant profile.

This design brings together gemstone color and structured symmetry to create a ring that feels both expressive and refined.

Product Information
SKU SHP-RINGS0821190473
Width 11.8 mm
Height 4.5 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 0.70 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 7 Pieces
Total Weight 0.70 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
amethyst-rings

FAQs About: 3/4 CT Round Shape Amethyst Cluster Flower Ring

What is a cluster ring?
A cluster ring features multiple smaller gemstones arranged closely together to create a larger design or decorative pattern.
What does a flower ring design represent?
Flower ring designs are inspired by natural floral shapes and are often chosen for their decorative and symbolic appearance.
What is amethyst used for in jewelry?
Amethyst is a purple gemstone widely used in jewelry because of its distinctive color and ability to complement many design styles.
Why are round cut gemstones popular?
Round cut gemstones are popular because their symmetrical shape enhances light reflection and creates balanced visual proportions.
Are cluster rings considered statement jewelry?
Cluster rings often appear more decorative than single-stone rings because of their multiple gemstones and intricate arrangement.
What occasions are amethyst rings suitable for?
Amethyst rings can be worn for everyday jewelry styling as well as special occasions due to their vibrant color and decorative appeal.