Round Lab Grown Diamond Floral Cluster Engagement Ring

Sale price $1,571.00 Regular price $1,806.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

A proposal can feel even more personal when the ring carries a design beyond the traditional solitaire. This flower cluster lab grown diamond engagement ring arranges seven round brilliant lab grown diamonds into a floral-inspired composition, creating layered sparkle across a wider surface. With approximately 0.77 carat total diamond weight and EF-VS quality, the ring brings together a symbolic flower motif and bright diamond brilliance for engagements, anniversaries, and meaningful milestones.

0.77 Carat Flower Cluster Lab Grown Diamond Engagement Ring

Seven round lab grown diamonds, each measuring approximately 3 x 3 mm, form the flower cluster and total about 0.77 carat. The white diamonds have brilliant cuts and EF-VS quality grading, with individual prong settings that allow the stones to remain clearly defined within the floral arrangement. The ring measures approximately 11.8 mm in width and 4.5 mm in height, giving the cluster noticeable dimension while maintaining a balanced engagement-ring profile.

Flower Cluster Lab Grown Diamond Ring Details

  • Seven round lab grown diamonds arranged in a flower cluster design
  • Approximately 0.77 carat total diamond weight
  • Approximately 3 x 3 mm round diamonds
  • Brilliant-cut white lab grown diamonds
  • EF-VS diamond quality grade
  • Individual prong settings for the diamond cluster
  • Approximately 11.8 mm ring width and 4.5 mm height
  • Approximate metal weight of 1.84 grams
  • Available in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K

The seven-stone arrangement creates more visual spread than a single-stone design, while the repeated round shapes preserve a cohesive floral pattern from the center outward.

Why Choose a Flower Cluster Diamond Engagement Ring

The flower motif gives this cluster engagement ring an emotional connection to growth, affection, and a relationship continuing to unfold. Rather than relying on one dominant diamond, seven round stones work together to create depth and light across the design. That makes the ring especially appealing for someone who wants a proposal piece with noticeable sparkle and a more artistic identity. The clustered arrangement also creates a larger visual presence while keeping each individual diamond part of the overall floral composition.

Lab Grown Diamond Craftsmanship & Authenticity

Rosec Jewels crafts the ring with attention to the alignment of the flower cluster, secure prong setting, and refined metal finishing. Each piece goes through stone inspection, a setting security review, and a finishing inspection before dispatch. Rosec Jewels also offers a Certificate of Authenticity with the jewelry for added product confidence. Care guidance supports responsible ownership, including gentle cleaning and proper storage to help maintain the diamonds, settings, and finish.

Styling and Wearing a Flower Cluster Engagement Ring

From above, the seven round diamonds create a defined floral silhouette with sparkle distributed across the full cluster; from the side, the approximately 4.5 mm height gives the design visible dimension. It can stand alone as a statement engagement ring or be coordinated with a wedding band according to personal style. The available sterling silver, yellow gold, and white gold choices also make it easier to coordinate the ring with an existing jewelry collection. Lab grown diamonds are suitable for regular wear, although mindful handling and periodic setting checks are recommended for a multi-stone prong-set design.

Product Information
SKU SHP-RINGS052410252
Width 11.8 mm
Height 4.5 mm
Weight 1.84 gm (Approximate)
Center Stone Weight 0.77 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 0.77 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-grown-diamond-engagement-rings

FAQs About: Flower Cluster Lab Grown Diamond Engagement Ring

How many lab grown diamonds are in this flower cluster engagement ring?

The ring contains seven round lab grown diamonds arranged in a flower-inspired cluster. Together, the diamonds have an approximate total weight of 0.77 carat.

What cut and quality are the lab grown diamonds?

The ring is set with round brilliant-cut white lab grown diamonds graded EF-VS. Each diamond measures approximately 3 x 3 mm.

What setting is used for the flower cluster diamonds?

The seven round lab grown diamonds are held in prong settings. The clustered arrangement forms the floral design while allowing each stone to remain visually distinct.

Why choose a flower cluster lab grown diamond ring for an engagement?

The seven-diamond flower arrangement provides a wider visual spread and layered sparkle compared with a traditional single-stone look. The floral motif can also represent growth and an unfolding relationship, making it a meaningful option for a proposal or commitment milestone.

What metal options are available for this lab grown diamond engagement ring?

The ring is available in 92.5 sterling silver as well as selected yellow and white gold options in 10K, 14K, and 18K, allowing the flower cluster design to be paired with different metal tones.

Does this flower cluster diamond ring come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with the jewelry as part of its product assurance and quality-focused customer experience.

Can this lab grown diamond cluster ring be worn regularly and how should I care for it?

Yes. Lab grown diamonds are suitable for regular wear, although a multi-stone prong setting benefits from mindful handling. Clean the ring gently with mild soap and water, store it separately when not in use, and periodically check the prongs to help keep the diamonds secure.