Round Freshwater Pearl and Diamond Bridal Drop Jewelry Set

Sale price $4,595.00 Regular price $5,162.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Like a whisper of forever captured in radiant elegance, this Freshwater Pearl Necklace and Earrings Set is designed to celebrate love, grace, and timeless beauty. Crafted to enchant at first glance, this exquisite pendant and earrings set showcases the flawless harmony of luminous freshwater pearls and sparkling lab grown diamonds. At the heart of each piece rests a round-shaped freshwater pearl, set in bead setting. Above the pearl sits a graceful infinity motif, symbolizing eternal love and endless connection. The infinity design is delicately adorned with brilliant lab grown diamonds that shimmer with exceptional fire and brilliance, adding a luxurious sparkle to the entire Infinity Pendant Set. The combination of radiant AAA quality freshwater pearls and dazzling EF-VS quality lab created diamonds creates an eye-catching look that feels both refined and romantic. The earrings are thoughtfully designed with secure screw-back closures, ensuring a comfortable and reliable fit throughout the day. Lightweight yet elegant, they provide effortless wear for brides, bridesmaids, or anyone looking to add sophistication to their jewelry collection. This bridal jewelry set is a symbol of elegance, purity, and everlasting affection. Whether gifted to a bride, loved one, or treasured as a personal keepsake, this Pearl and Diamond Necklace Set adds a touch of timeless glamour to every special moment.

Product Information
SKU SHP-PENDANT112035310
Length 30.7 mm
Width 11.4 mm
Metal Weight 8.50 gm (Approximate)
Total Stone Weight 23.38 Carat (Approximate)
FRESHWATER PEARL INFORMATION
No.of Stones 3 Pieces
Total Weight 22.96 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Round-8X8 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 55 Pieces
Total Weight 0.42 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-6 Pcs
Round-1.10X1.10 mm-9 Pcs
Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-3 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.60X1.60 mm-5 Pcs
Round-1X1 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade EF-VS
View More

Product Parent Collection Handle
infinity-jewelry