Round Diamond Swirl Stud Earring with Screw Back

Sale price $1,225.00 Regular price $1,408.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Add a refined curve of brilliance to your jewelry rotation with this Diamond Swirl Stud Earring with Screw Back. Two round diamonds sit within a compact swirl motif, combining the easy appeal of a diamond stud earring with a more distinctive flowing design. The secure screw-back closure makes this diamond swirl earring a practical choice for regular styling, milestone gifting, birthdays, anniversaries, and special occasions.

0.18 Carat Round Diamond Swirl Stud Earring with Screw Back

The swirl design is set with two round brilliant diamonds totaling approximately 0.18 carat. Each diamond measures about 2.40 x 2.40 mm and is held in a four-prong setting. Natural diamonds are offered in HI color and SI quality, while a lab grown diamond option is available in EF-VS quality. The earring measures approximately 6.7 mm long, 7 mm wide, and 2.3 mm high, with an approximate metal weight of 1.67 grams in 92.5 sterling silver.

What Makes This Diamond Swirl Stud Earring Special

  • Two round brilliant diamonds with an approximate combined weight of 0.18 carat.
  • Approximately 2.40 mm round diamonds create focused sparkle within the compact stud design.
  • Swirl-inspired silhouette adds flowing movement around the diamond accents.
  • Four-prong settings keep each round diamond clearly defined.
  • Choice of natural HI-SI diamonds or lab grown EF-VS diamonds.
  • Screw-back closure provides a secure fastening for regular wear.
  • Approximately 6.7 x 7 mm face size for a subtle but visible ear accent.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K .

Why Choose a Diamond Swirl Earring with Screw Back

The curved swirl transforms a simple diamond stud into a design with more visual movement while remaining compact enough for versatile styling. Two brilliant-cut round diamonds follow the motif rather than forming a conventional solitaire, creating sparkle across the surface from different angles. The secure screw-back construction also makes the design appealing for someone who wants a diamond stud earring that balances decorative detail with dependable fastening.

Diamond Stud Earring Authenticity & Craftsmanship

Rosec Jewels crafts the earring with attention to diamond alignment, four-prong security, screw-back construction, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the diamonds, closure, and sterling silver finish.

Styling the Diamond Swirl Stud Earring

The compact 6.7 x 7 mm profile makes this round diamond swirl stud easy to wear as a refined focal point or alongside other understated earrings. Its sterling silver tone creates a bright frame around the diamonds and coordinates naturally with silver-toned necklaces, rings, and bracelets. The screw-back design supports secure everyday and occasion styling, while the swirl motif gives the piece enough character for birthdays, anniversaries, and jewelry gifting.

Product Information
SKU SHP-EARRINGS062016320
Length 6.7 mm
Width 7 mm
Height 2.3 mm
Metal Weight 1.67 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 4-Prong-Setting
Quality Grade SI
View More

FAQs About: Diamond Swirl Stud Earring with Screw Back

How much diamond weight is in this swirl stud earring?

The earring features two round brilliant diamonds with an approximate combined weight of 0.18 carat. Each diamond measures about 2.40 x 2.40 mm.

What diamond quality options are available for this stud earring?

The earring is available with natural diamonds in HI color and SI quality or lab grown diamonds in EF-VS quality.

What setting is used for the round diamonds?

Each round brilliant diamond is secured in a four-prong setting, keeping the stones clearly visible within the swirl design.

What are the dimensions of the diamond swirl stud earring?

The earring measures approximately 6.7 mm in length, 7 mm in width, and 2.3 mm in height, creating a compact stud profile with visible diamond sparkle.

What metal is confirmed for this diamond stud earring?

The confirmed design is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 1.67 grams.

Why choose a diamond stud earring with a screw back?

A screw-back closure fastens onto the threaded post to provide a more secure fit than a conventional push back when properly tightened. This makes it a useful feature for regular wear and occasions where dependable fastening is preferred.

Does this diamond swirl earring come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided for ongoing maintenance.