Round Cut Natural Diamond Petal Stud Earrings

Regular price $1,447.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with our Classic Diamond Petal Earrings. Round Cut Diamonds on a designer motif for timeless elegance.

Product Information
SKU SHP-EARRINGS032210368
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 0.10 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-2 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.50X1.50 mm-2 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings