Round Cut Moissanite Infinity Engagement Ring for Her

Regular price $2,411.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Round Cut Moissanite Infinity Engagement Ring

This engagement ring highlights a round cut moissanite center stone paired with an infinity-inspired band design. The round cut shape is widely appreciated for its balanced proportions and ability to reflect light effectively, giving the center stone a brilliant appearance.

Combined with the infinity motif, the design brings together classic gemstone brilliance with symbolic meaning often associated with commitment and continuity.

Infinity Band Design

The infinity motif within the band forms a continuous flowing pattern that creates visual movement along the ring. This design element adds character to the band while framing the center stone in a graceful and balanced way.

Infinity-inspired jewelry designs are often chosen for engagement rings because the continuous pattern symbolizes enduring connection and lasting commitment.

Moissanite Center Stone

Moissanite is known for its strong brilliance and light reflection, making it a popular gemstone choice for engagement rings. The round cut enhances these qualities by allowing light to reflect evenly across the stone’s facets.

Moissanite gemstones are created without traditional mining, although the environmental impact can vary depending on the production methods and energy sources used.

A Symbolic and Elegant Ring Style

Engagement ring designs that combine symbolic motifs with classic gemstone shapes create a balance between visual elegance and personal meaning. The infinity band adds decorative structure while allowing the round center stone to remain the focal point.

This design approach emphasizes gemstone brilliance, flowing metalwork, and a refined silhouette that reflects both modern and timeless jewelry aesthetics.

Product Information
SKU SHP-RINGS082218045
Width 5.7 mm
Height 5.7 mm
Metal Weight 3.70 gm (Approximate)
Center Stone Weight 0.52 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 21 Pieces
Total Weight 0.71 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Round-1.20X1.20 mm-6 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1X1 mm-4 Pcs
Round-0.90X0.90 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Reverie-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-jewelry

FAQs About: Round Cut Moissanite Infinity Engagement Ring for Her

What does an infinity engagement ring symbolize?
An infinity engagement ring features a continuous looping design that is often associated with the idea of lasting connection and enduring commitment.
Why is the round cut popular for engagement rings?
The round cut is popular because it is designed to maximize light reflection, creating strong brilliance and balanced symmetry in the gemstone.
What is moissanite used for in engagement rings?
Moissanite is commonly used as a center stone in engagement rings because of its strong brilliance and durability, which contribute to its bright and reflective appearance.
How does an infinity band affect the ring design?
An infinity band introduces a flowing pattern that creates visual movement along the ring while framing the center gemstone with a decorative structure.
Why choose a symbolic engagement ring design?
Symbolic engagement ring designs incorporate motifs such as infinity patterns to represent meaning while maintaining the visual elegance of traditional ring styles.