Real Ruby Semi Eternity Ring

Regular price $2,081.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Timeless Design with Meaningful Detail

>

The Real Ruby Semi Eternity Ring offers a refined balance between classic elegance and everyday wearability. Featuring a sequence of stones along the band, it creates a continuous visual flow while maintaining a comfortable and practical design.

This ring is well suited for stacking, milestone gifts, or as a meaningful addition to an existing jewelry collection.

Semi Eternity Setting with Practical Comfort

The semi eternity design places stones along the upper portion of the band, allowing for a smooth underside that enhances comfort during daily wear. This structure combines visual detail with ease of use.

The arrangement ensures consistent sparkle while maintaining a balanced and wearable profile.

Ruby Stone Characteristics

Ruby is valued for its rich color and distinct presence, offering a vibrant and recognizable look. Its appearance makes it a popular choice for those seeking a bold yet refined gemstone.

With proper care, ruby jewelry can be worn regularly while preserving its visual appeal.

High-Level Features Buyers Appreciate

The semi eternity design provides continuous detail without compromising comfort. The consistent arrangement of stones enhances the overall look while allowing flexibility in styling.

This ring can be worn alone for a minimal look or stacked with other bands for a more layered style.

Product Information
SKU SHP-RINGS032151535
Width 1.5 mm
Height 1.4 mm
Weight 1.76 gm (Approximate)
RUBY INFORMATION
No.of Stones 9 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-2X2 mm-9 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Bar-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
ruby-rings

FAQs About: Real Ruby Semi Eternity Ring

What is a semi eternity ring?
A semi eternity ring features stones set along the top portion of the band rather than all the way around.
Is ruby suitable for everyday wear?
With proper care, ruby can be worn regularly while maintaining its appearance.
Is this ring comfortable for daily use?
Yes, the semi eternity design provides a smoother underside, enhancing comfort for everyday wear.
Can this ring be stacked with others?
Yes, it can be easily paired with other rings to create a layered look.
Does a semi eternity ring have symbolic meaning?
It is often associated with continuity and milestones, making it a meaningful choice for special occasions.
Who is this ring ideal for?
It is ideal for individuals seeking a balance of elegance, comfort, and versatility in a band ring.