Real Princess Cut Garnet Diamond Engagement Ring with Infinity Heart Shank

Sale price $1,703.00 Regular price $1,913.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Bold Garnet with Symbolic Detail

The Real Princess Cut Garnet Diamond Engagement Ring with Infinity Heart Shank combines rich color with meaningful design. At its center, a princess cut garnet offers deep red tones and clean geometric lines. The infinity heart shank adds symbolic character, making this ring a thoughtful choice for proposals or milestone celebrations.

Infinity Heart Shank & Setting Design

The infinity heart motif is integrated into the shank, creating a flowing pattern that represents continuity and connection. Diamond accents enhance the overall brilliance while framing the center stone without overpowering it. The structured setting supports the princess cut garnet securely, maintaining balance between decorative detail and everyday practicality.

Garnet Characteristics & Wear

Garnet is appreciated for its saturated red color and clarity. As a natural gemstone, subtle variations in tone may occur, adding individuality to each ring. While suitable for regular wear, mindful use during high-impact activities and periodic professional inspections are recommended to help preserve the stone and its setting.

Key Highlights

  • Princess cut garnet: sharp lines with deep red brilliance.
  • Infinity heart shank: symbolic and decorative band detail.
  • Diamond accents: added sparkle around the center stone.
  • Metal options available: select your preferred metal directly from the product page.
Product Information
SKU SHP-RINGS0821164839
Width 3 mm
Height 6 mm
Metal Weight 2.38 gm (Approximate)
Center Stone Weight 1.40 Carat (Approximate)
GARNET INFORMATION
No.of Stones 1 Pieces
Total Weight 1.40 Carat (Approximate)
Dimension(approx) Princess Cut-6X6 mm-1 Pcs
Color Red
Cut Brilliant
Shape Princess Cut
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-26 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
january-birthstone-jewelry
Is garnet suitable for an engagement ring?
Garnet can be chosen for engagement rings by those who appreciate its rich red tone. Mindful wear and periodic inspection help maintain its appearance over time.
What does the infinity heart design represent?
The infinity heart motif is often associated with enduring connection and continuity, adding symbolic meaning to the ring’s design.
Can this ring be paired with a wedding band?
Yes, depending on the band style and profile, it can be paired with compatible wedding bands to create a coordinated set.
Are different metal options available?
Available metal options can be selected directly from the customization section on the product page.
How should I clean this garnet ring?
Clean gently using mild soap, lukewarm water, and a soft cloth. Avoid harsh chemicals and store separately to help protect the stone and metal finish.