Real Peridot Heart Pendant with Diamond Accent Bail

Regular price $3,128.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

In case you thought that a heart pendant cannot be timelessly trendy, take a look at this heart pendant that showcases a heart shape peridot set on a heart-sequel motif with an interesting twist. Having been secured with prongs, the olive-green gemstone captivates the eye without much effort. Suspended from a shiny bail that is meticulously dotted with graduating diamonds, the pendant necklace can make anyones day happier. Wear it alone to grab all the eyeballs.

Product Information
SKU SHP-PENDANT032214933
Metal Weight 3.90 gm (Approximate)
Total Stone Weight 2.14 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 1 Pieces
Total Weight 2.10 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
peridot-necklaces