Real Diamond Octopus Stud Earrings for Women

Regular price $2,270.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These exquisite Diamond Stud Earrings are sure to elevate your look with their distinctive beauty. Embellished with Round Cut Diamonds set in Pave Setting over an octopus motif and crafted from luxurious metal, these Animal Stud Earrings offer a truly opulent appeal. The captivating Octopus design of these earrings is not only eye-catching but also features a secure Screw Back Closure to keep them in place. As the April birthstone, these Diamond Octopus Earrings would make a delightful addition to any jewelry collection and serve as a unique and thoughtful birthday gift for your special someone. Expect a priceless reaction when your loved one opens the box and sees the charm, shine, and delicate beauty of this meaningful diamond accessory. Carefully packaged in a signature jewelry box and offered in various metal colors, these Gothic Earrings are designed to perfectly match your love story. They capture attention, ignite conversations, and make unforgettable moments even more enchanting.

Product Information
SKU SHP-EARRINGS072210100
Metal Weight 2.25 gm (Approximate)
Total Stone Weight 0.31 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 60 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-20 Pcs
Round-0.90X0.90 mm-10 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1X1 mm-28 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings