Real Diamond Floral Earring for Cartilage Piercing

0
Regular price $1,043.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Discover the charm of this Flower Earring, where sparkling round cut diamonds takes center stage in a delicately crafted flower-shaped frame. The intricate design captures light beautifully, adding a luminous sparkle that draws attention. Designed for multiple ear placements, this piece is ideal for the helix, cartilage, upper lobe, or rook, making it a versatile addition to any jewelry collection. The flat back closure ensures it sits securely and comfortably, giving confidence for all-day wear. Each diamond is carefully selected for HI clarity and SI clarity, creating a radiant effect that enhances the natural elegance of the ear. The floral motif adds a touch of femininity while maintaining a modern aesthetic, making it suitable for a wide range of personal styles. Its compact size and thoughtful design allow it to complement other earrings seamlessly, creating a distinctive yet harmonious look. Crafted with precision, this Diamond Cartilage Earring is not only a stunning accessory for yourself but also a meaningful gift for a daughter, sister, friend, or loved one, perfect for celebrating milestones, achievements, or special occasions. Every detail reflects quality and artistry, from the secure setting of the diamond to the finish of the frame. This Diamond Piercing Earring offers a way to express individuality and style with subtle brilliance.

Product Information
SKU SHP-BODYJ072210005
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.05 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-4 Pcs
Round-1.40X1.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings