Real Blue Sapphire and Diamond Leaf Inspired Promise Ring

Sale price $1,708.00 Regular price $1,877.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Promise Ring Inspired by Nature

This blue sapphire and diamond promise ring is designed for those who appreciate symbolic and nature-inspired details. The leaf motif introduces a sense of organic flow, creating a meaningful design that reflects growth and connection.

Its balanced composition makes it suitable for everyday wear while maintaining a distinctive presence.

Leaf-Inspired Design with Thoughtful Structure

The leaf-inspired setting brings soft curves and natural movement into the design. This structure enhances the overall visual appeal while maintaining a refined and balanced look.

The arrangement of stones follows the flow of the design, ensuring both aesthetic harmony and secure placement.

Blue Sapphire and Diamond Combination

Blue sapphire is valued for its deep and rich tone, offering a timeless and elegant appearance. Its color provides depth while complementing a wide range of styles.

Diamond accents add subtle brilliance, enhancing the design with light contrast and refinement.

Comfortable and Versatile Wear

Designed with everyday wear in mind, this ring offers a comfortable fit and balanced structure. Its form supports ease of movement while maintaining stability.

It can be worn alone as a meaningful piece or paired with other rings for a layered style.

Product Information
SKU SHP-RINGS0821209717
Width 2.9 mm
Height 3.7 mm
Weight 1.52 gm (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.95 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 6 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
mothers-day-gifts

FAQs About: Real Blue Sapphire and Diamond Leaf Inspired Promise Ring

What does a leaf-inspired design represent?
A leaf-inspired design often symbolizes growth, renewal, and a natural connection.
Is this ring suitable for daily wear?
Yes, its balanced structure and secure setting make it suitable for regular use with proper care.
What makes blue sapphire a popular choice?
Blue sapphire is known for its rich color and timeless appeal, offering both elegance and versatility.
Are the diamond accents noticeable?
Yes, they add subtle brilliance that enhances the overall design without overpowering it.
Can this ring be stacked with others?
Yes, it can be paired with other rings for a layered and personalized look.
How should this ring be maintained?
Clean gently with a soft cloth and avoid harsh chemicals to preserve its appearance.