Real Black Spinel Blooming Flower Engagement Ring with Diamond

Regular price $3,055.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Evoke the beauty of love in full bloom with this Flower Engagement Ring, a piece where nature and romance intertwine effortlessly. At its center is a 5 mm Round Shape Black Spinel, set delicately within a rose shaped flower motif that symbolizes passion, devotion and timeless elegance. Surrounding the bloom, the band flows with nature inspired details, adorned with petite Diamond stones that catch the light like morning dew on petals, adding a soft, enchanting sparkle. Thoughtfully crafted, this Flower Shaped Engagement Ring creates a design that is both feminine and bold, perfect for the woman whose love is as unique as it is deep. The contrast of the dark AAA Quality Black Spinel with the glimmering HI-SI Quality Diamond stones creates a subtle drama. This Black Spinel Diamond Ring is ideal for everyday wear while remaining a statement of commitment and heartfelt emotion. Presented in a signature jewelry box and available in multiple ring sizes, this Black Spinel Engagement Ring transforms a simple gesture into a lasting promise. This Black Spinel Ring for Women is a symbol of a love that blossoms with every moment.

Product Information
SKU SHP-RINGS0821187973
Width 6 mm
Height 8 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.59 Carat (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-spinel-engagement-rings