Real Amethyst Flower Engagement Ring with Diamond

Regular price $2,540.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of blooming flowers and the purity of true love, this Flower Engagement Ring is a romantic piece designed to symbolize growth, devotion and new beginnings. At the center of the design lies a radiant 5 mm Round shaped Amethyst set in Claw Setting, glowing with rich purple tones that represent loyalty, peace and deep emotional connection. Surrounding the center stone is a three petal flower motif adorned with shimmering Diamond stones, creating a graceful design that reflects love blossoming beautifully over time. The sparkling Diamond stones add brilliance and elegance, enhancing the floral design with a soft yet eye-catching charm. Perfect as an engagement ring, promise ring, anniversary gift, or a heartfelt token of eternal love, this Amethyst Engagement Ring carries a romantic meaning that goes far beyond its beauty. Its nature-inspired design brings together timeless elegance and modern femininity, making this Amethyst Diamond Ring suitable for both everyday wear and special occasions. Presented in a signature jewelry box and available in various ring sizes, this Nature Inspired Engagement Ring is a treasured symbol of love that continues to bloom with every passing chapter.

Product Information
SKU SHP-RINGS032224023
Width 9.7 mm
Height 4 mm
Metal Weight 1.92 gm (Approximate)
Total Stone Weight 0.93 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-6 Pcs
Round-2.40X2.40 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-engagement-rings