Pave Set Lab Grown Diamond Double Cross Charm Necklace

Sale price $2,158.00 Regular price $2,481.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Symbolic Elegance with Contemporary Detail

The Pavé Set Lab Grown Diamond Double Cross Charm Necklace is designed for those who appreciate meaningful jewelry with refined brilliance. The double cross motif creates visual depth and layered symbolism, making it suitable for both personal expression and thoughtful gifting. Its balanced proportions allow it to be worn daily or styled for special occasions.

Pavé Setting with Defined Structure

The pavé setting enhances the surface of each cross with closely set diamonds, creating a continuous shimmer across the design. This setting style allows multiple small stones to reflect light collectively while maintaining a smooth and structured profile. The double cross arrangement adds dimension without appearing bulky, keeping the necklace visually light and versatile.

Lab Grown Diamond Composition

The necklace features lab grown diamonds created without traditional mining. Lab grown diamonds share the same physical, chemical, and optical properties as natural diamonds. Environmental impact varies by production and energy source. Exact grading, dimensions, and metal details are provided in the product specification tables above.

High-Level Features

  • Double cross charm design for layered visual appeal.
  • Pavé set lab grown diamonds for consistent surface brilliance.
  • Certified stones with detailed grading information listed above.
  • Crafted in precious metal options as specified in the product tables.
Product Information
SKU SHP-PENDANT022510075
Metal Weight 3.80 gm (Approximate)
Total Stone Weight 0.49 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 23 Pieces
Total Weight 0.49 Carat (Approximate)
Dimension(approx) Round-2.10X2.10 mm-1 Pcs
Round-1.90X1.90 mm-2 Pcs
Round-1.80X1.80 mm-7 Pcs
Round-1.70X1.70 mm-1 Pcs
Round-1.60X1.60 mm-4 Pcs
Round-1.50X1.50 mm-4 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1.20X1.20 mm-3 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Pave Set Lab Grown Diamond Double Cross Necklace

Is the necklace sold with the chain included?
Yes, the necklace includes the chain unless otherwise specified in the product details above.
Are the lab grown diamonds certified?
Yes, certification details for the lab grown diamonds are listed in the product specification tables.
Is pavé setting suitable for everyday wear?
Pavé settings are designed to securely hold multiple small stones while maintaining a refined appearance. With proper care, they can be worn regularly.
What metal options are available for this necklace?
Available metal types and finishes are detailed in the product tables above.
Where can I review the diamond grading and specifications?
The full grading information, measurements, and material specifications are provided in the product detail tables above.