Nature Inspired Lab Grown Emerald Promise Ring with Diamond Halo

Regular price $2,346.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your promise with our Nature Inspired Promise Ring, a vision of elegance with a brilliant 6 mm Round Shaped Lab Created Emerald as the centerpiece. Encircled by a sparkling Lab Grown Diamond Floral Halo and adorned with a subtle leaf motif on the bypass shank, this Emerald Diamond Ring seamlessly blends natures beauty with modern minimalism. Meticulously crafted by Rosec Jewels, it stands as a testament to eco-conscious luxury, offering a conflict-free alternative that symbolizes your commitment in a uniquely captivating way.

Product Information
SKU SHP-RINGS122310150
Metal Weight 2.80 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-18 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More