Nature Inspired Black Spinel Flower Engagement Ring with Diamond

Sale price $2,051.00 Regular price $2,304.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Nature-Inspired Elegance with Artistic Character

This nature inspired black spinel flower engagement ring is created for those who appreciate organic design paired with strong visual contrast. The floral-inspired setting brings softness and symbolism, while the deep black spinel center stone adds bold personality and modern edge.

It is well suited for someone who wants an engagement ring that feels expressive, distinctive, and thoughtfully designed rather than traditional.

Floral Design with Diamond Detailing

The flower motif draws inspiration from natural forms, using petal-like elements to frame the center stone. Diamond accents are carefully placed to highlight the floral structure, adding light and dimension without overwhelming the design.

This setting creates visual balance by combining softness in form with defined craftsmanship.

Black Spinel as a Center Stone Choice

Black spinel is valued for its rich, uniform color and reliable durability, making it suitable for engagement jewelry. Its naturally dark appearance provides strong contrast against surrounding diamonds, enhancing clarity and definition.

As a gemstone option, black spinel appeals to those seeking a non-traditional alternative with lasting visual impact.

High-Level Features

  • Nature inspired floral engagement ring design
  • Black spinel center stone with diamond accents
  • Balanced proportions with expressive detailing
  • Distinctive style suited for statement wear
Product Information
SKU SHP-RINGS0821221655
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
black-spinel-engagement-rings

FAQs: Black Spinel Flower Engagement Ring

What makes a flower-inspired engagement ring unique?

Flower-inspired rings use organic shapes and petal-like elements to create a softer, nature-driven design that feels expressive and symbolic.

Is black spinel suitable for an engagement ring?

Black spinel is known for its durability and consistent color, making it suitable for engagement rings when worn with regular care.

How do diamonds enhance this design?

Diamond accents add contrast and brightness, helping define the floral structure and highlight the center stone.

Who is this ring best suited for?

This ring is ideal for someone who prefers non-traditional engagement jewelry with artistic and nature-inspired elements.

Can this ring be worn daily?

The ring can be worn regularly, though mindful wear and proper care are recommended to maintain its finish and stone integrity.