Natural Round Diamond Star Earring for Helix Piercing

0
Regular price $851.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Natural Diamond Star Helix Earring

This helix earring features a star-inspired design accented with natural round diamonds. The distinctive star shape introduces a decorative element while allowing the diamonds to reflect light and create subtle brilliance along the ear.

Designed specifically for helix piercings, the earring offers a refined and compact structure suitable for cartilage jewelry styling.

Helix Piercing Jewelry Design

Helix earrings are created for cartilage piercings located along the upper outer edge of the ear. These designs are typically compact and structured to sit comfortably while remaining visible as part of a curated ear arrangement.

Helix jewelry often complements additional piercings, allowing different earrings to work together as a coordinated ear styling concept.

Star Motif Earring Style

Star-shaped jewelry designs introduce a distinctive visual element that stands out while maintaining a delicate appearance. The geometric points of the star shape help frame the gemstones and guide light reflection across the surface.

This motif is commonly used in modern jewelry to add personality and symbolic detail to small-scale pieces such as cartilage earrings.

Natural Diamond Accents

Natural diamonds are valued for their ability to reflect light and produce brilliance. When used as accents in small jewelry designs, they add sparkle while maintaining a balanced overall appearance.

In helix earrings, diamond accents help ensure the piece remains visually striking despite its compact size.

Product Information
SKU SHP-BODYJ082210080
Weight 0.45 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Natural Round Diamond Star Earring for Helix Piercing

What is a helix earring?
A helix earring is jewelry designed for cartilage piercings located along the upper outer edge of the ear.
What is a star design earring?
A star design earring features a star-shaped structure that frames gemstones or decorative elements within the jewelry piece.
What are round diamonds?
Round diamonds are gemstones cut with multiple facets in a circular shape designed to maximize brilliance and light reflection.
Can helix earrings be worn with other piercings?
Helix earrings are often worn together with other ear piercings to create a layered or curated ear jewelry style.
Why are diamonds used in cartilage earrings?
Diamonds add brilliance and visual sparkle that helps small jewelry pieces remain noticeable even in compact designs.
Are helix earrings suitable for everyday wear?
Helix earrings are commonly worn as everyday jewelry because their compact structure allows them to sit securely within cartilage piercings.