Natural Round Diamond Flower Earring for Helix Piercing

Regular price $971.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your ear jewelry collection with this exquisite Diamond Flower Earring, a classic design that captures the beauty of nature through fine craftsmanship and radiant sparkle. Featuring delicately arranged marquise shaped motifs, this elegant earring forms a graceful floral shape, each petal accented with brilliant round cut diamonds. The diamonds are carefully set in secure prong setting. Designed for versatility, this Floral Diamond Earring is suitable for helix, cartilage, conch, or upper lobe piercings, making it a perfect choice for both single-stud styling and curated ear looks. The thoughtfully designed flat back closure provides a comfortable fit, ideal for extended wear without irritation, whether worn during the day or overnight. The flower motif symbolizes growth, beauty, and new beginnings, adding a meaningful layer to its timeless aesthetic. Elegant yet contemporary, this piece transitions effortlessly from everyday sophistication to special occasions, complementing both casual and formal outfits. Beautifully crafted with attention to detail, this Diamond Cartilage Earring makes a memorable and heartfelt gift. Ideal for birthdays, anniversaries, graduations, or Christmas, it is a thoughtful way to celebrate life’s milestones.

Product Information
SKU SHP-BODYJ0921397828
Length 4.2 mm
Width 7.7 mm
Height 1.5 mm
Metal Weight 0.60 gm (Approximate)
Total Stone Weight 0.04 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings