Natural Pear Emerald and Diamond Infinity Promise Ring

Regular price $2,089.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

If you are looking for a meaningful Promise Ring to gift your special woman this Valentine's Day, this Emerald and Diamond Ring from Rosec Jewels is a perfect choice. It is crafted to embody the strength and beauty of a lasting connection, showcasing two pear shaped emerald stones, each securely held in prongs and set horizontally. Between them, a gentle curve of round cut diamonds flows, creating a graceful infinity shape. Whether it is a promise to a partner, a gift for someone special, or a reminder of your own journey, this Two Stone Ring carries a subtle yet powerful message of connection and unity. The contrast between the AAA quality emerald and the bright sparkle of HI-SI quality diamonds results in a look that is both balanced and refined, offering beauty alongside symbolism. Every detail in this Emerald Infinity Ring is thoughtfully placed, making it a piece with a story. Its minimalist design fits seamlessly into any wardrobe, while the infinity motif adds emotional depth and timeless charm.

Product Information
SKU SHP-RINGS062210124
Metal Weight 1.76 gm (Approximate)
Total Stone Weight 0.53 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Green
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-2 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.50X1.50 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
promise-rings