Natural Ethiopian Rainbow Opal Crown Promise Ring with Diamond

Regular price $1,948.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Step into a fairytale with this Crown Promise Ring, a dreamy symbol of love, royalty and radiant beginnings. At the center of this enchanting design sits a glowing 4 mm Round Shape Ethiopian Opal set in Prong Setting, known for its mesmerizing play of colors. Placed at the center of a delicately crafted Crown and framed by sparkling Diamond stones, the Opal captures the depth and wonder of your connection. The regal crown motif adds a whimsical charm, perfect for the one who rules your heart. Whether you are marking a promise, celebrating a milestone or simply saying you are my queen, this Opal Diamond Ring turns the moment into pure magic. Designed for comfort and elegance, this Commitment Ring comes in a range of sizes for the perfect fit and arrives in a beautiful jewelry box, ready to gift and guaranteed to dazzle. Sparkly and full of charm, this Opalescent Ring is a wearable love story made just for her.

Product Information
SKU SHP-RINGS0821210649
Width 3.5 mm
Height 7 mm
Metal Weight 2.25 gm (Approximate)
Total Stone Weight 0.46 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 21 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-21 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-rings