Natural Emerald and Diamond Taurus Zodiac Pendant Necklace

Sale price $4,755.00 Regular price $5,226.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Carry a personal connection to the stars with this Natural Emerald Taurus Zodiac Constellation Necklace with Diamond. The medallion-style design interprets the Taurus constellation through bright diamond points, while a natural green emerald introduces a vivid gemstone accent. Created for Taurus-inspired self-expression, birthdays, milestones, or thoughtful zodiac gifting, the necklace blends celestial symbolism with fine gemstone detail.

0.89 Carat Emerald Taurus Constellation Necklace with Diamonds

The necklace combines one approximately 0.50 carat natural emerald with 13 natural diamonds totaling approximately 0.39 carat, bringing the approximate total stone weight to 0.89 carat. The round green emerald measures about 5 x 5 mm, has brilliant-cut faceting, AAA quality, and a pavé setting. The round diamonds are brilliant cut, graded HI color and SI quality, and also pavé set to form bright points within the Taurus constellation design. The confirmed version is crafted in 92.5 sterling silver with an approximate metal weight of 7.00 grams and can be selected with an 18-inch chain or without a chain.

What Makes This Taurus Emerald and Diamond Necklace Special

  • Celestial Taurus constellation motif arranged across a round medallion-style pendant.
  • One natural green emerald weighing approximately 0.50 carat.
  • Round 5 x 5 mm emerald with brilliant cut and AAA quality grade.
  • Thirteen natural round diamonds totaling approximately 0.39 carat.
  • Ten diamonds measure approximately 1.50 x 1.50 mm and three measure approximately 2 x 2 mm.
  • HI-SI brilliant-cut diamonds create the bright constellation points.
  • Approximate combined gemstone weight of 0.89 carat.
  • Confirmed in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18K with an approximate metal weight of 7.00 grams.
  • Available with an 18-inch chain or as the pendant without a chain.

Meaning Behind the Taurus Zodiac Constellation Design

The Taurus constellation gives this necklace a direct connection to personal zodiac identity, while the gemstone arrangement turns the star pattern into a wearable keepsake. The green emerald adds a strong point of color against the bright diamonds, helping the celestial design feel distinctive without losing its symbolic focus. This makes the necklace especially meaningful for Taurus birthdays, personal milestones, or gifting to someone who enjoys astrology-inspired jewelry.

Natural Emerald Necklace Authenticity & Craftsmanship

Rosec Jewels crafts its gemstone jewelry with attention to stone placement, pavé setting security, and refined finishing. A Certificate of Authenticity is offered with the jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the emerald, diamonds, and metal finish over time.

Styling a Taurus Constellation Emerald Necklace

The round constellation pendant creates a clear celestial focal point, while the green emerald adds color and the diamonds provide smaller points of brilliance. Wear it alone as a personal zodiac statement or pair it with simple diamond studs, emerald jewelry, or understated sterling silver pieces. Choosing the 18-inch chain creates a ready-to-wear necklace, while the pendant-only option lets you pair the design with a compatible chain you already own.

Product Information
SKU SHP-PENDANT042210258
Metal Weight 7.00 gm (Approximate)
Total Stone Weight 0.89 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.39 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-10 Pcs
Round-2X2 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
taurus-zodiac-sign-jewelry

FAQs About: Natural Emerald Taurus Zodiac Constellation Necklace with Diamond

What gemstones are used in this Taurus constellation necklace?

The necklace features one natural green emerald weighing approximately 0.50 carat and 13 natural round diamonds totaling approximately 0.39 carat. Together, the stones have an approximate combined weight of 0.89 carat.

What size and quality is the natural emerald?

The natural emerald measures approximately 5 x 5 mm and weighs about 0.50 carat. It is round, green, brilliant cut, graded AAA quality, and secured in a pavé setting.

How many diamonds are in the Taurus constellation design?

The necklace contains 13 natural round diamonds totaling approximately 0.39 carat. Ten measure about 1.50 x 1.50 mm and three measure about 2 x 2 mm. The diamonds are brilliant cut, graded HI color and SI quality, and pavé set.

What does a Taurus constellation necklace symbolize?

The necklace represents the star pattern associated with the Taurus zodiac sign. Its celestial design makes it a personal expression of zodiac identity and a meaningful choice for birthdays, milestones, or astrology-inspired gifting.

What metal and chain options are available for this Taurus necklace?

The confirmed version is crafted in 92.5 sterling silver and selected yellow rose or white gold options in 10K, 14K, and 18K with an approximate metal weight of 7.00 grams. It can be selected with an 18-inch chain or without a chain.

Does this emerald and diamond zodiac necklace come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Its quality process also includes stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for an emerald and diamond constellation necklace?

Clean the necklace gently with mild soap, lukewarm water, and a soft cloth, then dry it carefully. Keep it away from harsh chemicals and abrasive surfaces, store it separately when not worn, and periodically check the pavé settings and chain to help maintain secure wear.