Natural Diamond Petal Cartilage Earring

0
Regular price $938.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Delicate in scale yet full of character, this natural diamond petal cartilage earring brings a soft floral touch to curated ear styling. Its petal-inspired silhouette is accented with two round diamonds, creating a refined sparkle that feels personal, expressive, and easy to wear. Designed for helix, cartilage, tragus, conch, or upper lobe piercings, it adds a polished detail to everyday looks while still feeling special enough for meaningful gifting.

Petal Cartilage Earring with Natural Round Diamond

This single cartilage earring is crafted with round natural diamonds in prong settings, giving the petite petal design a bright, secure finish. The diamonds have an approximate total weight of 0.04 carat, with HI color, SI quality grade, and brilliant cut faceting. Available in white and yellow gold options, along with selectable flat back post lengths, it is made for a personalized fit in a modern ear stack.

What Makes This Special

The floral petal form gives this earring a gentle, nature-inspired identity without feeling overly ornate. Its compact design makes it suitable for cartilage-focused placements while still adding visible diamond sparkle.

The piece includes 2 round diamonds: one approximately 1.20X1.20 mm and one approximately 1.50X1.50 mm. Together, they create an approximate total diamond weight of 0.04 carat.

The diamonds are brilliant cut, HI color, SI quality grade, and secured in prong settings. The earring has an approximate weight of 0.54 gm and is sold singly, making it ideal for asymmetric styling or mixing with other cartilage earrings.

Why Choose This Design

A petal-inspired cartilage earring offers a softer alternative to simple studs or geometric body jewelry. The floral shape gives the piece a graceful visual rhythm, while the natural diamonds add refined brightness in a small, wearable scale.

The prong setting allows the diamonds to catch light while keeping the design clean and delicate. Flat back post length options support a more customized fit, helping the earring sit comfortably in helix, cartilage, tragus, conch, or upper lobe placements.

Design Meaning

The petal motif carries the feeling of growth, renewal, and natural beauty. In a cartilage earring, that symbolism becomes intimate and expressive, making the design a thoughtful choice for someone who loves floral jewelry, subtle sparkle, or meaningful details in a curated ear. It can mark a personal milestone, a new piercing, or simply a style choice that feels close to the wearer.

Authenticity & Craftsmanship

This earring is carefully crafted with attention to stone placement, prong security, refined finishing, and comfortable wear. Rosec Jewels offers a Certificate of Authenticity with the product, giving added confidence with your purchase. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. For lasting care, keep it away from harsh chemicals, store it separately, and clean it gently with a soft cloth after wear.

Style and Wearability

Lightweight and petite, this diamond earring can be styled as a single statement in a cartilage piercing or paired with other studs, hoops, and flat back earrings for a layered ear stack. Yellow gold adds warmth to the floral form, while white gold gives the diamonds a crisp, cool look. Its single-ear format makes it especially useful for curated, mismatched, or minimalist body jewelry styling.

Product Information
SKU SHP-BODYJ0921397103
Weight 0.54 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Natural Diamond Petal Cartilage Earring

What stones are used in the Natural Diamond Petal Cartilage Earring?

This earring features 2 round natural diamonds with an approximate total weight of 0.04 carat. The diamonds are brilliant cut, HI color, SI quality grade, and set in prong settings.

What is the design style of this cartilage earring?

The earring has a petal-inspired floral design accented with round diamonds. Its small, refined shape makes it suitable for delicate cartilage styling and curated ear looks.

Can this earring be worn in different piercings?

Yes. This earring is designed for helix, cartilage, tragus, conch, or upper lobe piercings, depending on the wearer’s piercing placement and preferred fit.

Is this diamond petal earring sold as a pair?

No. This cartilage earring is sold singly, making it ideal for one-ear styling, asymmetric looks, or mixing with other earrings in a curated stack.

What metal options are available for this earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Does this earring come with flat back options?

Yes. Flat back post length options are available, including 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, allowing the wearer to choose a fit suited to the piercing.

How should I care for this natural diamond cartilage earring?

Store the earring separately, wipe it gently with a soft cloth after wear, and avoid exposure to harsh chemicals, perfumes, and chlorine. Check the prongs periodically to help maintain secure stone placement.