Natural Diamond Paw Stud Earrings for Women

Regular price $9,138.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Cute and Stylish, these Paw Stud Earrings bring together charm, sparkle and a touch of playful elegance in one unique design. Handcrafted with care, each earring features a brilliant 5 mm Heart Shape Diamond that forms the base of a sweet paw print, while four dainty Round Shape Diamond stones complete the design, giving it an eye-catching finish. The paw motif is a beautiful symbol of unconditional love, loyalty and the special bond shared with pets, making these Dog Paw Earrings a heartfelt expression of affection and memories. Designed with a secure Screw Back Closure, these Paw Print Earrings offer comfort and confidence for everyday wear, ensuring they stay safely in place throughout the day. Their graceful style makes them perfect for casual outings, office wear or special occasions where a subtle sparkle adds the right amount of charm. Whether gifted to a pet lover, a close friend or someone who adores meaningful jewelry, these Diamond Heart Earrings carry warmth and personality in every detail. Presented in a signature jewelry box, these Diamond Studs are ready to impress from the moment they are opened. Perfect to wear with or can be ideal for gifting on birthdays, anniversaries or simply as a sweet surprise that celebrates love, companionship and a little sparkle of happiness.

Product Information
SKU SHP-EARRINGS0919592
Length 5.5 mm
Width 5.5 mm
Metal Weight 1.65 gm (Approximate)
Total Stone Weight 1.28 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 1.28 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-2 Pcs
Round-1.70X1.70 mm-8 Pcs
Color HI
Cut Brilliant
Shape Heart, Round
Setting Type Prong-Setting
Quality Grade SI
View More