Natural Diamond Lightning Bolt Necklace for Her

Regular price $2,288.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Distinctive Symbol in a Refined Silhouette

The Natural Diamond Lightning Bolt Necklace for Her is designed for those who prefer expressive jewelry with a clean, modern profile. The lightning bolt motif introduces a sense of movement and individuality while maintaining a minimal, wearable scale.

Suitable for daily styling or meaningful gifting, this necklace offers a balance between symbolism and subtle sparkle.

Lightning Bolt Design with Diamond Detail

The angular lightning bolt form creates visual interest without excess ornamentation. Diamond accents add controlled brilliance, highlighting the lines of the design rather than overpowering it.

The setting is crafted to keep the diamonds secure while allowing light to interact naturally with the stones.

Natural Diamond Characteristics

Natural diamonds are valued for their durability and light performance, making them suitable for regular wear when cared for properly.

Routine cleaning and periodic inspection help maintain the appearance and integrity of the setting over time.

High-Level Features

  • Lightning bolt motif design
  • Natural diamond accents
  • Designed for everyday layering or solo wear
  • Gift-appropriate and symbolic styling
Product Information
SKU SHP-PENDANT032155289
Length 31.5 mm
Width 5.5 mm
Metal Weight 3.00 gm (Approximate)
Total Stone Weight 0.16 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.16 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-1 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1X1 mm-2 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-0.80X0.80 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces
Is this necklace sold as a single piece?
Yes, this product includes one lightning bolt necklace as described on the page.
Are the diamonds natural?
Yes, the necklace features natural diamonds. Specific details regarding stone quality and size can be found in the product detail tables.
Can this necklace be worn every day?
Natural diamonds are suitable for regular wear. For longevity, it is recommended to avoid harsh chemicals and store the necklace safely when not in use.
Where can I find metal and dimension details?
Complete specifications, including metal options and measurements, are provided in the product detail tables on this page.
Is this necklace suitable as a gift?
The symbolic lightning bolt design and diamond detailing make it a thoughtful choice for birthdays, milestones, or personal celebrations.