Natural Diamond Cute Flower Stud Earrings with Screw Back

Regular price $1,429.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Delicate Floral Diamond Studs for Everyday Elegance

These natural diamond flower stud earrings are designed for those who prefer refined, wearable jewelry with a soft decorative touch. The floral motif brings a subtle charm, making them suitable for daily styling as well as thoughtful gifting.

Their balanced size and classic appeal make them an easy addition to both casual and occasion wear.

Floral Design with Structured Diamond Arrangement

The flower-inspired layout arranges diamonds in a symmetrical pattern, creating a cohesive and visually pleasing silhouette. This design enhances light reflection from multiple angles while maintaining a compact and neat form.

It offers a refined alternative to traditional round or solitaire studs.

Natural Diamond Composition

Natural diamonds are selected for their brilliance and timeless appeal. Their faceted surfaces reflect light to create a subtle sparkle that complements the floral arrangement without appearing excessive.

The result is a balanced look that combines softness in design with clarity in detail.

Secure Screw Back for Daily Wear

The screw back closure is designed to provide a more secure fit compared to standard push backs. This feature helps keep the earrings in place during extended wear, offering added confidence for everyday use.

It is especially suitable for those who prioritize stability and comfort in their jewelry.

Versatile Styling and Thoughtful Gifting

With their understated floral design, these earrings pair easily with a variety of jewelry styles, from minimal pieces to layered looks. Their gentle aesthetic also makes them a meaningful option for gifting on special occasions.

They are crafted to suit a wide range of personal styles while maintaining a timeless presence.

Product Information
SKU SHP-EARRINGS082210044
Weight 1.20 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings

Faq About: Natural Diamond Cute Flower Stud Earrings with Screw Back

Are screw back earrings more secure than push backs?
Screw back closures are designed to stay firmly in place, reducing the chance of the earrings loosening during wear.
Can these earrings be worn daily?
Yes, their compact design and secure backing make them suitable for everyday use when handled with care.
What makes the floral design different from standard studs?
The floral arrangement creates a more decorative and detailed look compared to single-stone studs while maintaining a balanced size.
Are natural diamonds suitable for everyday jewelry?
Natural diamonds are known for their durability and brilliance, making them well-suited for regular wear.
Do these earrings feel heavy on the ear?
Stud earrings with compact designs are generally lightweight and comfortable for extended wear.
Are these earrings suitable for gifting?
Their floral design and classic diamond styling make them a versatile and thoughtful gift option for various occasions.