Natural Diamond Curved Cartilage Earring with Flat Back

Sale price $1,681.00 Regular price $1,847.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Do you love little trendy earpieces in your ear stacking? Then you need this Diamond Curved Cartilage Earring.

  • Embellished with 100% real and certified pear shape diamonds on the inner side while additional round diamonds studded on the curved motif, crafted with Solid Gold Metal.
  • You can simply wear this diamond piercing earring on your Helix, Cartilage, or Upper Lobe Piercing. Its a playful, chic, and elegant piece of jewelry.
  • Go ahead and explore cute and trendy earrings in our piercing stud collection and pick a pair to create the ear stack of your dreams!
Product Information
SKU SHP-BODYJ052310074
Length 10.8 mm
Width 4.3 mm
Height 2.3 mm
Metal Weight 0.78 gm (Approximate)
Total Stone Weight 0.53 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.53 Carat (Approximate)
Dimension(approx) Pear-2X3 mm-4 Pcs
Round-1.10X1.10 mm-9 Pcs
Color HI
Cut Brilliant
Shape Pear, Round
Setting Type Prong-Setting
Quality Grade SI
View More