Natural Diamond Bow Promise Ring for Women

Regular price $2,036.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch of whimsy and elegance to this Diamond Promise Ring for Her that features a delicate bow motif adorned with brilliant Round Diamonds sparkling with every movement. The graceful bow design symbolizes a promise wrapped in love, making this Bow Promise Ring an ideal choice for marking a special occasion or celebrating a meaningful commitment. Its stackable design allows for versatile styling, effortlessly pairing with other rings or standing beautifully. This April Birthstone Ring complements the intricate bow, creating a harmonious balance between sophistication and playfulness. Whether given as a promise ring, a unique proposal ring or a delightful addition to your jewelry collection, this Promise Stackable Ring radiates both elegance and affection, while embracing the beauty and joy of a truly special piece. Easygoing, charming, and packed with significance, this is a piece you will enjoy wearing daily. At Rosec Jewels, every item is meticulously handcrafted and includes a gemstone authentication certificate, guaranteeing its quality and authenticity. Plus, this Bow Ring comes in a beautiful jewelry box, perfect for gifting or keeping as a treasured memento.

Product Information
SKU SHP-RINGS012012070
Width 2 mm
Height 5 mm
Metal Weight 2.02 gm (Approximate)
Total Stone Weight 0.19 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1X1 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
april-birthstone-jewelry