Natural Black Spinel Flower Band Ring for Women

Regular price $2,413.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

An unbroken circle of beauty and thoughtful design, this Flower Wedding Band is a celebration of love in its most charming form. The 2 mm Round Shape Black Spinel stones set in Prong Setting shimmer at the center of each intricately crafted Flower motif, creating a continuous row of blooms that seem to dance along the finger. The design captures the grace of nature while symbolizing growth, renewal and the everlasting bond between two hearts. This band feels effortless to wear every day, yet special enough to mark moments that matter. Its subtle sparkle and floral details make it perfect for the woman who loves pieces that are meaningful. The craftsmanship highlights each flower with care, allowing the AAA Quality Black Spinel to shine with a captivating allure. Presented in a signature jewelry box and available in various sizes, this Black Spinel Ring is ready to become a cherished symbol of devotion. Whether gifted as a promise or an anniversary, this Full Eternity Ring transforms a simple gesture into a timeless expression of love, one bloom at a time. This Eternity Wedding Band is a gentle reminder that true love, like a garden in full bloom, grows stronger every day.

Product Information
SKU SHP-RINGS0821186850
Width 8.2 mm
Height 2 mm
Metal Weight 3.75 gm (Approximate)
Total Stone Weight 0.42 Carat (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 14 Pieces
Total Weight 0.42 Carat (Approximate)
Dimension(approx) Round-2X2 mm-14 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-spinel-rings