Natural Black Opal Diamond Leaf Earrings with Screw Back

Sale price $1,809.00 Regular price $2,033.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch of enchanting beauty to her everyday style with these Leaf Earrings, crafted to bring nature-inspired elegance to life. At the center of each delicate Leaf motif rests a mesmerizing 5 mm Round Shape Black Opal set in Prong Setting, glowing with rich hues that shift like magic with every movement. Surrounding the AAA Quality Black Opal, sparkling HI-SI Diamond stones trace the gentle curves of the leaf design, creating a graceful shimmer that feels effortlessly romantic. The Screw Back Closure ensures a secure and comfortable fit, making these Black Opal Diamond Earrings perfect for all-day wear, whether she is heading to a special event or adding a little sparkle to a casual outfit. Beautifully versatile, they pair wonderfully with formal outfits or everyday looks. Arriving in a charming jewelry box and ready to gift, these Black Opal Earrings make a thoughtful choice for birthdays, anniversaries or any moment you want to make unforgettable. Elegant and crafted with care, this pair is sure to become one of her most cherished accessories.

Product Information
SKU SHP-EARRINGS032210938
Metal Weight 2.00 gm (Approximate)
Total Stone Weight 1.25 Carat (Approximate)
BLACK OPAL INFORMATION
No.of Stones 2 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
black-opal-earrings