Natural Aquamarine Star of David Necklace for Women

Sale price $2,067.00 Regular price $2,323.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace night sky magic with this stunning Star Pendant Necklace, designed to add a little sparkle to your everyday style. At the center of the charming Star motif lies a 4 mm Round Shape Aquamarine set in Prong Setting, glowing with a soft blue shimmer that feels calm and effortlessly beautiful. The star design gives it a playful yet elegant touch, making this Aquamarine Pendant Necklace perfect for women who love jewelry that feels meaningful but still modern. The gentle shine of the AAA Quality Aquamarine catches the light beautifully, adding just the right amount of glow. Finished with a secure Lobster Clasp Closure, this Womens Aquamarine Necklace sits comfortably and stays in place, whether you are at work, out with friends or attending a special event. This Celestial Necklace pairs easily with casual tops, dresses or layered looks, making this March Birthstone Necklace a versatile piece you will reach for again and again. Packed in a signature jewelry box, it is ready to gift for birthdays, anniversaries, festive occasions or as a sweet surprise for someone special.

Product Information
SKU SHP-PENDANT042170697
Length 18.7 mm
Width 12.6 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.25 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
aquamarine-necklaces