Natural 1 Carat Amethyst Infinity Pendant Necklace with Diamond

Regular price $2,412.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A symbol of endless love and timeless beauty, this Infinity Pendant Necklace is designed to make every moment feel special. The graceful Infinity Knot represents forever, beautifully detailed with petite Diamond stones that add a radiant sparkle. Resting elegantly over the design is a 6X8 mm Pear Shape Amethyst set in Prong Setting, glowing in a rich purple shade that brings depth and charm to the piece. The gentle curve of the Infinity motif paired with the vibrant gemstone creates a look that feels romantic yet modern. Suspended from a sleek chain and secured with a Lobster Clasp Closure, this Amethyst Pendant Necklace offers both comfort and confidence for daily wear. Whether styled with a work outfit or a dress for a special evening, it adds a meaningful touch and refined shine. Presented in a lovely jewelry box, this Amethyst Diamond Necklace is a heartfelt gift choice for anniversaries, birthdays, Valentine’s Day or any occasion that celebrates love and connection.

Product Information
SKU SHP-PENDANT042159302
Length 22 mm
Width 7 mm
Metal Weight 3.40 gm (Approximate)
Total Stone Weight 1.07 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 1.00 Carat (Approximate)
Dimension(approx) Pear-6X8 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.07 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-3 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-3 Pcs
Round-1X1 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
amethyst-necklaces