Moissanite Vintage Inspired Key Pendant Necklace

Sale price $2,274.00 Regular price $2,614.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Isn’t she the key to your happiness? Celebrate that special connection with this exquisite Moissanite Key Necklace, a piece designed to symbolize love, dreams, and new beginnings. Thoughtfully crafted, this meaningful Antique Key Necklace transforms a simple motif into a powerful expression of affection and inspiration. The pendant features a beautifully detailed key design, representing opportunity, hope, and the promise of a bright future. It is adorned with shimmering round cut moissanite stones that catch the light with every movement. Adding a touch of old-world charm, the head of the key is intricately designed with vintage-inspired patterns. These delicate details lend a sense of timeless beauty, blending classic artistry with modern sophistication. This Moissanite Pendant Necklace is more than just a piece of jewelry, it carries a message of encouragement and belief. Whether given as a romantic gesture or a thoughtful gift, it speaks volumes without saying a word. Ideal for birthdays, anniversaries, or simply to show appreciation, this Vintage Key Necklace is a heartfelt way to make her feel cherished.

Product Information
SKU SHP-PENDANT032213932
Metal Weight 4.20 gm (Approximate)
Total Stone Weight 0.31 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 10 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-9 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
key-necklaces