Moissanite Halo Engagement Ring for Her with Certificate

Regular price $2,915.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This stunning Round Moissanite Engagement Ring is a perfect blend of timeless elegance and thoughtful design. At the heart of this ring is a 7 MM brilliant round cut Moissanite, surrounded by a halo of sparkling stones that enhance its natural shine. The halo style not only amplifies the center stone's brilliance but also gives the ring a radiant and luxurious look from every angle. What truly sets this Classic Engagement Ring apart is the intricate attention to detail. The ring features 3 MM sparkling side stones on either side of the center, adding extra charm and dimension to the overall design. The band is further lined with smaller round stones that extend halfway along the shank, bringing a continuous sparkle to the piece. Take a closer look beneath the center stone and you will discover a beautifully crafted gallery adorned with a delicate floral motif. This hidden detail adds a unique, romantic touch, perfect for those who appreciate artistry in the smallest elements. The gentle curves and openwork in the gallery give this Halo Engagement Ring a graceful profile while maintaining strength and comfort. This 1 Carat Moissanite Ring is a timeless statement of love and commitment. Whether for a proposal, anniversary, or special moment, this moissanite ring is an unforgettable symbol of your journey together.

Product Information
SKU SHP-RINGS062016735
Width 7.5 mm
Height 9 mm
Metal Weight 3.68 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 31 Pieces
Total Weight 2.21 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-12 Pcs
Round-1.50X1.50 mm-16 Pcs
Round-3X3 mm-2 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings