Moissanite and Evil Eye Disc Pendant Necklace

0
Regular price $3,268.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Rosec Jewels designed this stunning Evil Eye Pendant to complement your beauty and shield your aura. This Moissanite Pendant is more than just a piece of jewelry, it is a symbol of protection, positivity, and elegance. It features a mesmerizing enamel-filled round disc with a center evil eye motif adorned with dazzling round cut D-VS1 quality moissanite stones in pave setting and deep blue enamel detailing. Whether it is a birthday, an anniversary, Halloween, Christmas, New Year, or any special occasion, this Disc Necklace makes a meaningful gift, reminding your loved one that they are always protected and cherished.

Product Information
SKU SHP-PENDANT032214192
Metal Weight 5.50 gm (Approximate)
Total Stone Weight 0.41 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 29 Pieces
Total Weight 0.41 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-22 Pcs
Round-1.50X1.50 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
evil-eye-jewelry