Minimal Moissanite Infinity Pendant in Pave Setting

Regular price $2,636.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Minimal Moissanite Infinity Pendant Necklace

This pendant necklace features an infinity-inspired design accented with moissanite gemstones set in a pavé style. The flowing infinity shape represents continuity and balance, while the small gemstones add light reflection across the surface of the design.

The minimal structure of the pendant allows the symbolic shape to remain the focal point, creating a piece that can be worn as a subtle everyday accessory or as part of layered jewelry styling.

Infinity Pendant Design

The infinity symbol is commonly used in jewelry to represent continuity, connection, and enduring relationships. Its flowing, symmetrical shape creates a balanced design that works well in delicate pendant styles.

Because of its recognizable form, the infinity motif is frequently chosen for jewelry pieces intended to express personal meaning or thoughtful gifting.

Pavé Setting Structure

A pavé setting involves placing multiple small gemstones closely together along the surface of the jewelry. This technique creates a continuous sparkle effect while allowing the underlying metal structure to remain subtle.

The closely set gemstones enhance light reflection across the pendant, adding visual texture without overwhelming the minimalist design.

Moissanite Gemstone Characteristics

Moissanite is known for its strong brilliance and ability to reflect light with noticeable sparkle. The gemstone’s optical properties allow smaller stones to produce visible light reflection in pavé jewelry settings.

Moissanite gemstones are created without traditional mining, although environmental impact may vary depending on production methods and energy sources.

Minimal Pendant Styling

Minimal pendant necklaces are designed to complement a variety of jewelry styles without dominating an outfit. Their refined size and balanced design make them suitable for daily wear as well as layered necklace combinations.

The infinity motif paired with pavé-set moissanite creates a pendant that combines symbolic design with subtle brilliance.

Product Information
SKU SHP-PENDANT072210180
Metal Weight 4.20 gm (Approximate)
Total Stone Weight 0.28 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 28 Pieces
Total Weight 0.28 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-26 Pcs
Round-1X1 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
infinity-jewelry

FAQs About: Minimal Moissanite Infinity Pendant in Pave Setting

What does the infinity symbol represent in jewelry?
The infinity symbol is commonly associated with continuity, lasting connections, and enduring relationships.
What is a pavé setting?
A pavé setting places multiple small gemstones closely together so that they appear to form a continuous surface of sparkle.
What is moissanite?
Moissanite is a gemstone known for its strong brilliance and light reflection, often used in fine jewelry as a sparkling center or accent stone.
Is an infinity pendant suitable for everyday wear?
Infinity pendants are commonly designed with a minimal structure that makes them suitable for everyday wear and layering with other necklaces.
Why use small gemstones in pavé jewelry?
Small gemstones in pavé settings create a continuous sparkle effect across the jewelry surface while maintaining a delicate appearance.
Can a minimal pendant be layered with other necklaces?
Minimal pendants are often designed to pair well with other necklaces, making them suitable for layered jewelry styling.