Marquise Moissanite Leaf Earring for Helix Piercing

Regular price $763.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Marquise Moissanite Leaf Helix Earring

This Marquise Moissanite Leaf Earring is designed specifically for helix piercings, combining a refined gemstone with a nature-inspired silhouette. The marquise shaped moissanite creates an elegant focal point while the surrounding structure forms a subtle leaf motif.

The elongated gemstone shape enhances the organic design of the piece, creating a balanced and graceful look suited for cartilage jewelry.

A Nature Inspired Leaf Design

Leaf motifs are frequently used in fine jewelry because they evoke natural elegance and delicate structure. In this design, the marquise gemstone aligns naturally with the shape of a leaf, allowing the gemstone and metalwork to work together visually.

The slim proportions and curved lines help the earring sit neatly along the ear, complementing the placement of helix piercings while maintaining a refined appearance.

The Appeal of Marquise Cut Moissanite

Moissanite is admired for its bright sparkle and clear appearance. The marquise cut features an elongated form with pointed ends, which creates a distinctive silhouette and enhances the reflective qualities of the gemstone.

Moissanite is created without traditional mining, though the environmental impact may vary depending on production processes and energy sources used during manufacturing.

Designed for Helix Piercings

Helix jewelry is crafted to suit the upper cartilage area of the ear. Pieces designed for this location often feature compact forms and refined detailing that complement the natural contours of the ear.

With its marquise moissanite center stone and leaf-inspired design, this earring offers a distinctive option for those who appreciate subtle gemstone sparkle combined with nature-inspired styling.

Product Information
SKU SHP-BODYJ052210165
Metal Weight 0.33 gm (Approximate)
Total Stone Weight 0.20 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 5 Pieces
Total Weight 0.20 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-5 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Marquise Moissanite Leaf Earring for Helix Piercing

What is a helix piercing?
A helix piercing is placed along the upper cartilage of the ear. Jewelry designed for this location is typically compact and shaped to sit comfortably on the outer ear.
Why is the marquise cut used in jewelry?
The marquise cut features an elongated shape with pointed ends, which creates a distinctive appearance and enhances the gemstone’s brilliance.
What makes moissanite popular for earrings?
Moissanite is valued for its brightness and clarity, making it a widely chosen gemstone for earrings and other fine jewelry pieces.
Is moissanite a mined gemstone?
Moissanite used in jewelry is typically created without traditional mining. Environmental impact can vary depending on production methods and energy sources.
Why are leaf designs popular in jewelry?
Leaf motifs are popular because they represent natural elegance and delicate form. These designs often create a graceful and organic appearance in jewelry.
Are helix earrings different from standard earrings?
Helix earrings are designed for cartilage piercings on the upper ear, so they are often smaller and shaped to fit comfortably in that specific area.