Marquise Diamond Leaf Earring for Cartilage Piercing

Regular price $1,024.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by nature, introducing the Marquise Diamond Leaf Earring! Showcasing sparkling Marquise and Round Diamonds studded on the leaf motif.

  • This bling is all about that snug fit in your Cartilage, Helix, or Upper Lobe Piercing, the simple flat back closure will keep it locked in place.
  • Whether youre brunching with the crew or spicing up date night, our Gold Leaf Earring is your go-to accessory. Get ready to slay, and let the leaves do the talking!
  • Make your special ones day extra-lit with this stunning Diamond Piercing Earring. Its the ultimate gift for birthdays or anniversaries.
Product Information
SKU SHP-BODYJ082410083
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.12 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-2 Pcs
Round-1.50X1.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More