Marquise Cut Moissanite Solitaire Celtic Knot Ring in Bezel Setting

Regular price $1,743.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Refined Expression of Lasting Symbolism

This Marquise Cut Moissanite Solitaire Celtic Knot Ring in a bezel setting is designed for those who seek a meaningful symbol of commitment with refined visual balance. The elongated marquise shape draws the eye while maintaining a comfortable profile on the finger, and the Celtic trinity knots reflect values of life, love, and eternity rather than mere ornamentation.

Whether chosen for an engagement, a promise, or a milestone celebration, the thoughtful design supports daily wear without distraction. Each element of this ring has been considered to offer visual harmony and enduring character.

Design & Setting

The bezel setting frames the marquise moissanite securely, reducing the risk of snagging and providing a smooth edge that enhances wearability. This inward-wrapping metal technique also protects the facets of the stone while allowing light to interact with its elongated silhouette. The Celtic knot detailing beside the stone subtly integrates cultural symbolism into the overall aesthetic, offering visual interest without overwhelming the center gem.

Stone & Value Considerations

The center moissanite, graded D-VS1 for color and clarity, offers high brilliance and a crisp visual presence without traditional mining impact. Moissanite’s hardness and resilience suit frequent wear, and its creation without traditional mining aligns with values around responsible sourcing and impact awareness.

High-Level Features to Know

This ring combines refined proportion, protective bezel craftsmanship, and symbolic Celtic details. Its balanced profile supports everyday comfort, and its design communicates intention and enduring connection.

Product Information
SKU SHP-RINGS0821223590
Width 2.4 mm
Height 8.2 mm
Metal Weight 2.33 gm (Approximate)
Center Stone Weight 0.77 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.77 Carat (Approximate)
Dimension(approx) Marquise-4X8 mm-1 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Bezel Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
promise-rings

FAQs About: Marquise Cut Moissanite Celtic Knot Bezel Ring

What makes a bezel setting suitable for daily wear?

A bezel setting encircles the stone’s edges with metal, offering protection from knocks and reducing snagging risks compared with prong styles.

How do I choose the right ring size?

Use a reliable ring sizer or consult the sizing guide to find a comfortable fit, especially if wearing daily.

Is moissanite suitable as an engagement ring stone?

Yes. Moissanite is a durable, high-brilliance gemstone with a hardness that supports frequent wear, making it an appropriate choice for engagement rings.

What does the Celtic knot symbolize?

The Celtic trinity knot is commonly interpreted as a motif representing interconnected concepts such as life, love, and eternity.