London Blue Topaz Floral Engagement Ring with Diamond

Regular price $3,911.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Deep, expressive, and full of romantic detail, this London Blue Topaz floral engagement ring brings a distinctive bloom-inspired look to a meaningful promise. A 5 mm round London Blue Topaz rests at the heart of the design, surrounded by a petal-like arrangement of round diamonds that gives the ring a graceful floral silhouette. Its rich blue center and diamond accents create a proposal ring with personality, color, and a soft sense of celebration.

London Blue Topaz Floral Engagement Ring with Diamond Halo

Designed with a 0.60 carat approximate London Blue Topaz center stone, this engagement ring balances vivid color with delicate sparkle. The round brilliant-cut blue gemstone is secured in a prong setting and framed by 20 round brilliant-cut diamonds weighing approximately 0.84 carat in total. The floral halo gives the ring a feminine, blooming profile, while the sleek band keeps the focus on the center stone and diamond-set flower motif.

What Makes This Special

  • Center stone: 1 round London Blue Topaz, approximately 0.60 carat total weight.
  • Center stone size: approximately 5 x 5 mm.
  • Gemstone quality: AAA London Blue Topaz with blue color and brilliant cut.
  • Diamond accents: 20 round brilliant-cut diamonds, approximately 0.84 carat total weight.
  • Diamond quality: HI color and SI quality grade.
  • Design style: floral engagement ring with a petal-inspired diamond halo.
  • Approximate ring dimensions: 12.6 mm width and 5 mm height, with an approximate weight of 3.70 gm.
  • Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.
  • Ring sizes are available from US 3.0 to US 13.0, along with a mail-me ring sizer option.

Why Choose This Design

The round London Blue Topaz gives the ring a classic center-stone shape while adding a rich blue tone that feels more personal than a traditional all-diamond design. Its prong setting allows the gemstone to remain visually open, helping the color stand out from the surrounding diamond petals. The floral halo adds dimension and sparkle around the center stone, making the ring feel expressive without becoming overly ornate. With several precious metal choices, the design can be styled in a cool white finish or a warmer yellow gold tone to suit different preferences.

Design Meaning

The floral design gives this ring a gentle sense of growth, renewal, and devotion. The London Blue Topaz sits like the heart of a flower, while the diamond accents form a blooming halo around it. This makes the ring especially meaningful for a proposal, anniversary, or promise that marks the beginning of a new chapter. Its flower-inspired form speaks to love that continues to open, deepen, and become more radiant with time.

Authenticity & Craftsmanship

This London Blue Topaz and diamond engagement ring is carefully crafted with attention to stone placement, setting security, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to your purchase. Before dispatch, each piece goes through stone inspection, a setting security review, and finishing inspection to help ensure the ring is prepared with care. For lasting brilliance, keep the ring away from harsh chemicals, store it separately when not in use, and clean it gently as part of regular jewelry care.

Style and Wearability

The floral halo gives this ring a graceful face-up presence, while the narrower band keeps the overall look refined on the finger. From above, the diamond accents create a blooming frame around the blue center stone; from the side, the raised profile adds dimension without taking away from the balanced silhouette. It pairs well with simple diamond bands, plain metal bands, or can be worn on its own as a statement of color and commitment. Its romantic floral character makes it a thoughtful choice for proposals, anniversaries, milestone gifts, or a personal ring with symbolic meaning.

Product Information
SKU SHP-RINGS032210235
Width 12.6 mm
Height 5 mm
Weight 3.70 gm (Approximate)
Center Stone Weight 0.60 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 0.60 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Accent
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-8 Pcs
Round-2.70X2.70 mm-4 Pcs
Round-2X2 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Accent
Quality Grade SI
View More

Product Parent Collection Handle
london-blue-topaz-engagement-rings

FAQs About: London Blue Topaz Floral Engagement Ring with Diamond

What makes this London Blue Topaz ring suitable for a proposal?

This ring has a romantic floral design centered with a round London Blue Topaz and surrounded by diamond accents. The blue center stone adds individuality, while the diamond halo gives the ring a celebratory sparkle suited for a proposal, anniversary, or meaningful commitment.

What does the floral design symbolize?

The floral design symbolizes love in bloom, growth, renewal, and a relationship that continues to flourish. The London Blue Topaz forms the center of the flower, while the diamond accents create a petal-inspired frame around it.

What stone cut is used in this engagement ring?

The center stone is a round brilliant-cut London Blue Topaz measuring approximately 5 x 5 mm and weighing approximately 0.60 carat. The accent diamonds are also round brilliant cut, creating consistent sparkle around the floral halo.

Does this ring include diamond accents?

Yes. The ring includes 20 round brilliant-cut diamond accents with an approximate total weight of 0.84 carat. These diamonds are arranged around the London Blue Topaz in a floral halo design.

What metal options are available for this ring?

This ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, allowing the design to be customized in a cooler or warmer metal tone.

Does this London Blue Topaz ring come with authenticity support?

Yes. Rosec Jewels offers a Certificate of Authenticity with the product. The ring also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this London Blue Topaz and diamond ring?

Store the ring separately when not in use, avoid exposure to harsh chemicals, and clean it gently with suitable jewelry care methods. Regular care helps protect the London Blue Topaz, diamond accents, metal finish, and setting over time.