Lab Grown Ruby Heart Promise Ring with Diamond Halo

Sale price $1,362.00 Regular price $1,566.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Romantic Heart Ruby Promise Ring

The Lab Grown Ruby Heart Promise Ring with Diamond Halo is designed to symbolize love and meaningful commitment. The heart-shaped ruby sits at the center of the design, creating a striking focal point that reflects emotion and personal significance. Its vibrant color and graceful shape make it a thoughtful choice for marking special milestones or expressing a heartfelt promise.

Elegant Halo Design

A delicate halo of diamonds surrounds the heart-shaped ruby, adding brightness and visual depth to the ring. This design enhances the center stone while creating a balanced and refined appearance. The halo setting also frames the gemstone beautifully, allowing its shape and color to remain the primary focus.

Lab Grown Ruby Beauty

Lab grown ruby offers the rich red color traditionally associated with the gemstone while being created without traditional mining. The environmental impact can vary depending on production methods and energy sources, but lab-created gemstones provide an alternative approach to traditional gemstone sourcing.

Meaningful for Everyday Sentiment

This promise ring is designed for individuals who want a piece of jewelry that represents connection and sentiment. The heart motif combined with the halo accent creates a design that feels both timeless and expressive, making it suitable for everyday wear or meaningful gifting occasions.

Product Information
SKU SHP-RINGS0821220308
Width 3.5 mm
Height 6.6 mm
Metal Weight 1.90 gm (Approximate)
Total Stone Weight 0.53 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-1 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.08 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-20 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
july-birthstone-jewelry
What does a heart-shaped promise ring symbolize?
A heart-shaped promise ring is commonly associated with love, affection, and emotional commitment. Many people choose this style to express a meaningful promise or milestone in a relationship.
What is a halo setting in a ring?
A halo setting features a circle of smaller stones surrounding the center gemstone. This design enhances the appearance of the center stone and adds additional sparkle to the ring.
Are lab grown rubies real gemstones?
Yes. Lab grown rubies have the same chemical and optical properties as natural rubies but are created in controlled environments rather than mined from the earth.
Can a promise ring be worn every day?
Many promise rings are designed for regular wear. Proper care and avoiding strong impacts can help maintain the ring’s appearance over time.
How should a ruby ring be cleaned?
A ruby ring can be cleaned with mild soap, warm water, and a soft brush. Rinse thoroughly and dry gently with a lint-free cloth before storing it safely.