Lab Grown Diamond Round Solitaire Stud Earrings with Screw Back

Regular price $2,771.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make the heads turn when you walk with these Floral Stud Earrings featuring a 6 MM Round Shape Diamond (Lab Grown) set in a Prong Setting as a center stone. Embracing the delicate essence of nature, these Flower Earrings feature a Floral Motif accentuated by delicate Ef-Vs quality diamond gemstones. The Screw Back Closure ensures a secure fit, allowing you to adorn yourself with confidence. Perfect as a gift, an anniversary present, a birthday surprise, or even a thoughtful Valentines Day Gift, these Diamond Studs celebrate love and beauty, creating cherished memories for the special women in your life. Meticulously designed by Rosec Jewels, these Lab Grown Diamond Earrings harmonize luxury with exquisite craftsmanship.

Product Information
SKU SHP-EARRINGS012410131
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 2.23 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 2.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-32 Pcs
Round-6X6 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More