Lab Grown Diamond Bridal Drop Earrings

Regular price $4,309.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These Lab Grown Diamond Drop Earrings are stunning, elegant, and timeless, effortlessly enhancing your outfit and drawing attention to you. Made from high-quality metal, these Teardrop Earrings boast a classic design, making them a versatile and timeless jewelry piece that makes a bold statement. Adorned with round cut lab created diamonds in pave setting, these Wedding Earrings feature a teardrop motif surrounded by a halo of round gemstones. They dangle from a delicate flower positioned just above the teardrop, sparkling with the diamonds. The upper section is embellished with more round brilliant cut diamonds, connected by a latch back for added security. The striking and bold appearance of these Bridal Drop Earrings exudes glamour with their intricate design, instantly elevating your look. They also bring an extra touch of elegance and a sophisticated vibe that moves gracefully with you. This pair of Diamond Dangle Earrings embodies understated luxury that captures attention, making them a fantastic choice for parties or special occasions, while also adding volume to your overall appearance.

Product Information
SKU SHP-EARRINGS062510056
Metal Weight 6.38 gm (Approximate)
Total Stone Weight 2.39 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 166 Pieces
Total Weight 2.39 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-10 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.40X1.40 mm-6 Pcs
Round-1.50X1.50 mm-62 Pcs
Round-1.60X1.60 mm-8 Pcs
Round-1.70X1.70 mm-4 Pcs
Round-1.80X1.80 mm-2 Pcs
Round-1X1 mm-40 Pcs
Round-2.50X2.50 mm-8 Pcs
Round-2X2 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade EF-VS
View More