Lab Grown Black and White Diamond Flower Stud Earrings

Sale price $1,494.00 Regular price $1,717.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Old world charm with a bold twist defines this pair of Vintage Flower Earrings. Inspired by classic heirloom jewelry, the design features round shape lab created black diamonds placed at the center, framed by a halo of white diamonds arranged in a detailed floral pattern. The contrast between the center stones and the surrounding gems creates depth and character, giving the Black and White Earrings a strong yet graceful personality. The floral motif feels romantic and artistic, while the carefully crafted designer setting adds texture. The blend of vintage inspiration with a modern edge makes the pair stand out effortlessly. Created as stud earrings for women, they offer a balanced size that works beautifully for formal gatherings, weddings, evening events, or styled everyday wear. Screw back closures ensure a secure and comfortable fit, keeping the Black Diamond Earrings steady throughout the day. Perfect as a meaningful gift or as a personal statement piece, these Floral Stud Earrings carry individuality and charm. Unique in design and rich in detail, they blend tradition with confidence, making them a memorable addition to any fine jewelry collection.

Product Information
SKU SHP-EARRINGS112027550
Metal Weight 1.61 gm (Approximate)
Total Stone Weight 0.69 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.39 Carat (Approximate)
Dimension(approx) Round-3X3 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Other-Setting-Type
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Other-Setting-Type
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-black-diamond-earrings