Heart Shape Ruby and Diamond Bar Dangle Pendant For Women

Sale price $2,778.00 Regular price $3,053.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Celebrate affection with a Heart Shape Ruby and Diamond Bar Dangle Pendant designed around rich red color and delicate diamond sparkle. At its center is an approximately 0.65 carat heart-shaped Ruby, complemented by nine round Diamonds along the bar-inspired dangle design. Crafted in 92.5 sterling silver, this Ruby and Diamond pendant brings romantic symbolism into a distinctive silhouette suited to anniversaries, birthdays, relationship milestones, or a meaningful jewelry gift.

Heart Shape Ruby and Diamond Bar Dangle Pendant

The focal Ruby measures approximately 5 x 5 mm and carries an AAA quality grade. Its heart shape and brilliant cut enhance the gemstone's vivid red presence, while a prong setting keeps the outline clearly defined. Nine brilliant-cut round Diamonds, totaling approximately 0.12 carat, add bright contrast with HI color and SI quality. Together, the Ruby and Diamonds provide an approximate total stone weight of 0.77 carat. The pendant can be selected with an 18-inch chain or without a chain.

Heart-Shaped Ruby Pendant with Diamond Accents

  • One approximately 0.65 carat AAA Ruby in a 5 x 5 mm heart shape
  • Brilliant-cut Ruby secured in a prong setting
  • Nine round brilliant-cut Diamonds totaling approximately 0.12 carat
  • HI color and SI quality Diamond accents in prong settings
  • Approximately 0.77 carat total combined stone weight
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K
  • Available with an 18-inch chain or without a chain

Romantic Ruby Heart and Diamond Dangle Design

The heart-shaped Ruby gives this pendant an immediate connection to love and affection, making the design especially fitting for romantic gifts and personal milestones. Its saturated red center remains the visual focus, while the line of smaller Diamonds introduces contrast and movement without competing with the Ruby. The bar dangle format also gives the familiar heart motif a more contemporary profile, creating a piece that feels meaningful while remaining distinctive enough for personal styling.

Ruby and Diamond Pendant Authenticity & Craftsmanship

This Ruby and Diamond pendant is carefully crafted with attention to stone placement, secure prong settings, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added product confidence. Before dispatch, each piece goes through stone inspection, setting security review, and finishing inspection. Care guidance is also provided to help you maintain the Ruby, Diamonds, chain, and sterling silver over time.

Styling a Heart Ruby and Diamond Pendant Necklace

The red heart-shaped Ruby creates a noticeable focal point from the front, while the vertical Diamond detailing adds light and length to the pendant's appearance. Choose the 18-inch chain for a ready-to-wear Ruby necklace or select the pendant without a chain if you prefer to style it with an existing one. Its romantic color and compact gemstone arrangement pair naturally with everyday necklines, celebration outfits, and understated Diamond or sterling silver jewelry, making it a thoughtful choice for birthdays, anniversaries, Valentine's gifting, and personal keepsakes.

Product Information
SKU SHP-PENDANT032214813
Metal Weight 3.30 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Heart-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.12 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-9 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-necklace

FAQs About: Heart Shape Ruby and Diamond Bar Dangle Pendant

What stones are used in the Heart Shape Ruby and Diamond Bar Dangle Pendant?

The pendant features one heart-shaped Ruby weighing approximately 0.65 carat and nine round Diamonds with an approximate combined weight of 0.12 carat. The total stone weight is approximately 0.77 carat.

What cut and setting are used for the Ruby and Diamonds?

The approximately 5 x 5 mm heart-shaped Ruby has a brilliant cut and is secured in a prong setting. The nine Diamond accents are also brilliant cut, round in shape, and held in prong settings.

What quality grades do the Ruby and Diamond accents have?

The red Ruby is graded AAA quality. The round Diamond accents are listed with HI color and SI quality, adding contrasting sparkle around the Ruby-focused design.

Does this Ruby and Diamond pendant come with a chain?

The pendant is available with an 18-inch chain or without a chain, allowing you to choose a ready-to-wear necklace or pair the pendant with a compatible chain you already own.

Is a heart-shaped Ruby pendant suitable for romantic gifting?

Yes. The heart-shaped red Ruby gives the design a clear association with love and affection, while the Diamond accents add celebratory sparkle. This makes the pendant well suited to anniversaries, birthdays, Valentine's gifting, relationship milestones, and other meaningful occasions.

Does the Ruby and Diamond pendant come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. The piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this sterling silver Ruby and Diamond pendant?

Wipe the pendant gently with a soft, clean cloth after wear and store it separately to reduce scratching. Keep it away from harsh chemicals, perfumes, and abrasive cleaners, and periodically check the prong settings and chain to help maintain secure wear.