Heart Shape Moissanite Flower Conch Earring

Regular price $1,119.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Romantic Detail for Cartilage Styling

This heart shape moissanite flower conch earring in gold is designed for those who prefer expressive, artistic ear styling. The heart-shaped moissanite is arranged in a floral-inspired silhouette, creating a delicate yet eye-catching look for conch piercings.

Its compact structure makes it suitable for cartilage placement, offering a refined accent that complements curated ear stacks.

Floral Form with Heart-Cut Brilliance

The heart-shaped moissanite forms the focal point of the floral composition, blending romantic symbolism with modern piercing design. The gold setting enhances warmth while providing structural support for secure placement.

The flower-inspired layout softens the heart motif, creating balanced proportions that suit both minimal and layered ear arrangements.

Moissanite for Everyday Sparkle

Moissanite is valued for its brilliance and durability, making it suitable for daily wear in cartilage jewelry. It offers strong light performance while maintaining resilience in smaller, precision settings.

This stone choice allows for refined sparkle without overwhelming the delicate scale of a conch earring.

High-Level Features

This conch earring features a heart shape moissanite arranged in a floral-inspired design and crafted in gold. It is created for cartilage placement, emphasizing secure structure, balanced proportions, and elegant shine.

Product Information
SKU SHP-BODYJ012210423
Length 6.5 mm
Width 6.5 mm
Height 2.4 mm
Weight 0.90 gm (Approximate)
MOISSANITE INFORMATION
No.of Stones 4 Pieces
Total Weight 0.46 Carat (Approximate)
Dimension(approx) Heart-3X3 mm-4 Pcs
Color White
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings

FAQs About: Heart Shape Moissanite Flower Conch Earring in Gold

Is this earring suitable specifically for conch piercings?
Yes, it is designed for cartilage placement, making it suitable for conch piercings when fitted according to your piercing dimensions.
What makes a heart shape moissanite ideal for a conch earring?
The heart shape adds a romantic touch while remaining compact enough for cartilage styling, offering brilliance without excessive size.
Is moissanite durable for cartilage jewelry?
Moissanite is a durable gemstone known for its hardness and sparkle, making it well-suited for everyday wear in secure cartilage settings.
Does the floral design make it bulky on the ear?
The design is proportioned for cartilage placement, offering decorative detail while maintaining a balanced and comfortable profile.
How should I care for a gold conch earring with moissanite?
Clean gently with mild soap and lukewarm water, rinse thoroughly, and dry with a soft cloth to maintain shine and clarity.