Heart Shape London Blue Topaz Drop Pendant with Diamond

Regular price $2,413.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Deep blue color, a romantic heart silhouette, and a diamond-framed drop design come together in this London Blue Topaz pendant made for meaningful moments. The heart-shaped center stone brings a rich, expressive glow, while the surrounding diamond halo and diamond-studded bail add a graceful shimmer that catches attention without feeling overpowering. It is a thoughtful choice for birthdays, anniversaries, romantic gifts, personal milestones, or a keepsake that speaks of affection with refined detail.

Heart Shape London Blue Topaz Drop Pendant with Diamond Halo

This drop pendant is designed with a 0.25 carat approximate heart-shaped London Blue Topaz in a prong setting, framed by 17 round brilliant cut diamonds with a total diamond weight of 0.31 carat approximate. The pendant carries a soft romantic shape with added sparkle along the halo and bail, creating a polished gemstone necklace that feels expressive, wearable, and gift-ready. It is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, with the option to select it with an 18 inch chain or without chain.

What Makes This Special

The center stone is a single heart-shaped London Blue Topaz measuring approximately 4 x 4 mm, graded AAA and cut in a brilliant style to enhance its blue depth and lively reflection. Its prong setting keeps the heart shape defined, allowing the gemstone to remain the emotional focal point of the pendant.

A diamond halo surrounds the topaz, while additional diamonds on the bail continue the sparkle upward. The 17 round brilliant cut diamonds are graded HI color and SI quality, with an approximate total weight of 0.31 carat. The result is a compact yet detailed drop pendant with a balanced mix of color, shine, and romantic symbolism.

With an approximate product weight of 2.64 gm, the pendant is designed to feel refined and comfortable, making it easy to style for both intimate occasions and polished everyday dressing.

Why Choose This Design

A heart-shaped gemstone carries instant emotional appeal, but the London Blue Topaz gives this pendant a richer and more distinctive personality. Its deep blue tone adds depth to the romantic form, making the piece feel expressive rather than overly sweet. The diamond halo brightens the center stone and gives the pendant a more finished presence, while the diamond bail adds movement and light from the neckline.

The prong setting is a fitting choice for this design because it keeps the heart outline clear and lets more light interact with both the London Blue Topaz and diamonds. Multiple metal options allow the pendant to be personalized around the wearer’s preferred tone, from cool white metals to warm yellow gold finishes.

Design Meaning

The heart motif makes this pendant a natural symbol of love, devotion, and emotional closeness. Paired with the rich blue of London Blue Topaz, the design feels sincere, calm, and deeply personal. It can mark a promise, celebrate a relationship, honor a milestone, or simply become a daily reminder of someone cherished. The diamond halo surrounding the heart adds the feeling of protection and celebration, giving the pendant a romantic message with a polished jewelry finish.

Authenticity & Craftsmanship

Rosec Jewels crafts this pendant with careful attention to gemstone placement, prong security, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure the pendant is ready to be worn or gifted with confidence. A Certificate of Authenticity is included with the product, and care guidance is provided to help customers preserve the shine, setting integrity, and overall appearance of their jewelry over time.

Style and Wearability

This London Blue Topaz pendant brings color close to the neckline in a way that feels graceful and personal. The heart drop creates a soft focal point, while the diamond halo gives it enough sparkle for dinners, celebrations, date nights, and meaningful gifting occasions. With the 18 inch chain option, it sits at a classic necklace length that layers well with simpler chains or stands confidently on its own. It pairs especially well with diamond studs, blue gemstone accents, or minimal gold jewelry, depending on the selected metal.

Product Information
SKU SHP-PENDANT032214764
Weight 2.64 gm (Approximate)
Center Stone Weight 0.25 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 17 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-10 Pcs
Round-1X1 mm-4 Pcs
Round-2.40X2.40 mm-1 Pcs
Round-2X2 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
topaz-necklaces

FAQs About: Heart Shape London Blue Topaz Drop Pendant with Diamond

What makes this London Blue Topaz pendant a meaningful gift?

The pendant combines a heart-shaped London Blue Topaz with a diamond halo, giving it a clear romantic meaning and a polished gift-ready look. Its heart motif makes it suitable for anniversaries, birthdays, romantic occasions, and personal milestones.

What is the center stone in this pendant?

The center stone is one heart-shaped London Blue Topaz with an approximate weight of 0.25 carat. It measures approximately 4 x 4 mm, has a brilliant cut, blue color, AAA quality grade, and is held in a prong setting.

Does this pendant include diamonds?

Yes. The pendant includes 17 round brilliant cut diamonds with an approximate total weight of 0.31 carat. The diamonds are arranged around the London Blue Topaz and along the bail, with HI color and SI quality grade.

What metal options are available for this pendant?

This pendant is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, allowing the design to be matched with the wearer’s preferred jewelry tone.

Can this pendant be ordered with a chain?

Yes. The pendant offers a chain option with an 18 inch chain, and it can also be selected without a chain for buyers who prefer to wear it with an existing necklace chain.

Does this pendant come with a Certificate of Authenticity?

Yes. Rosec Jewels includes a Certificate of Authenticity with the product. Each piece is also checked for stone inspection, setting security, and finishing quality before dispatch.

How should I care for this London Blue Topaz and diamond pendant?

Store the pendant separately in a soft jewelry pouch or box, avoid harsh chemicals, and clean it gently with a soft cloth. For long-term care, keep the prong settings away from rough impact and have the pendant checked periodically if worn often.