Genuine Tanzanite and Diamond Nature Engagement Ring with Split Shank

Regular price $2,339.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Distinctive Color with Nature-Inspired Form

The Genuine Tanzanite and Diamond Nature Engagement Ring with Split Shank is designed for those drawn to expressive color and organic detail. Tanzanite’s rich violet-blue tone becomes the focal point, offering a distinctive alternative to traditional clear center stones.

Paired with diamond accents, this engagement ring balances vibrant color with refined brilliance, making it suitable for proposals that reflect individuality and personal style.

Nature Motif with Split Shank Structure

The split shank design creates visual openness along the band, drawing the eye toward the center stone while adding architectural strength to the setting.

Nature-inspired detailing introduces subtle curves and flow, softening the overall silhouette and enhancing the ring’s dimensional presence on the finger.

Tanzanite and Diamond Considerations

Tanzanite is valued for its saturated color and unique character. As a gemstone used in fine jewelry, it benefits from mindful wear and periodic inspection to help preserve its surface over time.

Diamond accents add contrast and light reflection, supporting everyday engagement styling when cared for properly.

High-Level Features

  • Genuine tanzanite center stone
  • Diamond accents for added brilliance
  • Nature-inspired detailing
  • Split shank engagement ring design
Product Information
SKU SHP-RINGS0821221727
Width 3.8 mm
Height 7 mm
Metal Weight 2.38 gm (Approximate)
Center Stone Weight 0.54 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-engagement-rings
Is tanzanite suitable for an engagement ring?
Tanzanite can be worn as an engagement ring center stone when handled with care. Regular cleaning and periodic inspection help maintain its appearance over time.
What does a split shank design mean?
A split shank band divides into two sections as it approaches the center stone, creating visual openness and emphasizing the focal gemstone.
How should I care for a tanzanite and diamond ring?
Gentle cleaning with mild soap and water is generally recommended. Avoid harsh chemicals and remove the ring during activities that may cause impact.
Where can I view exact specifications?
Detailed information about metal options, gemstone size, and other specifications is available in the product detail tables on this page.
Is this ring designed for proposals?
Yes, this ring is styled as an engagement ring, combining a prominent center stone with accent diamonds and a defined band structure.