Genuine Heart Shape London Blue Topaz and Diamond Flower Necklace

Sale price $2,847.00 Regular price $3,198.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elegance blooms beautifully in this captivating London Blue Topaz Pendant Necklace, a perfect blend of grace and modern charm. At the heart of the design lies a stunning floral arrangement crafted from heart-shaped London Blue Topaz gemstones. Enhancing the floral motif are delicate round diamond accents placed between the petals. These shimmering stones add a touch of sparkle and create a beautiful contrast against the bold blue gemstones. At the center, a brilliant diamond draws the entire design together, giving the Flower Pendant a radiant focal point that captures attention with subtle elegance. The Blue Topaz and Diamond Pendant is suspended from a sleek and polished chain, designed to sit gracefully along the neckline. Its balanced size and lightweight feel make it comfortable for daily wear while still making a stylish statement. Crafted with precision and attention to detail, this Blue Topaz Heart Necklace is a timeless addition to any jewelry collection. Whether paired with formal attire or worn to elevate a simple outfit, it brings a refined and polished look every time.

Product Information
SKU SHP-PENDANT032215442
Metal Weight 4.00 gm (Approximate)
Total Stone Weight 1.88 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 6 Pieces
Total Weight 1.50 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-6 Pcs
Color Blue
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 0.38 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-1 Pcs
Round-2X2 mm-6 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
topaz-necklaces