Genuine Emerald Leaf Earrings with Diamond

Regular price $1,839.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Indulge in the beauty of nature with these Leaf Earrings, a delicate and enchanting accessory that brings elegance to every look. Crafted in Precious Metal, each earring features a 3X5 mm Pear Shape Emerald slantly placed over a leaf motif, perfectly lined with sparkling Diamond stones that catch the light with every movement. The intricate design combines timeless charm with refined sophistication, making it ideal for both everyday wear and special occasions. Secure Screw Back Closure ensures a comfortable fit, so you can wear them confidently from morning to night without worry. Whether paired with flowing dresses or tailored outfits, these Emerald Diamond Earrings add a fresh, vibrant touch that elevates any ensemble. Beautifully packaged in a jewelry box, these Emerald Stud Earrings also make a thoughtful gift for birthdays, anniversaries or as a cherished token for someone who loves nature inspired elegance.

Product Information
SKU SHP-EARRINGS042157452
Length 11.3 mm
Width 5.5 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.53 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-2 Pcs
Color Green
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 34 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-12 Pcs
Round-0.90X0.90 mm-22 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-earrings